Lineage for d1wsta1 (1wst A:13-415)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705624Protein Multiple substrate aminotransferase, MSAT [142655] (1 species)
  7. 705625Species Thermococcus profundus [TaxId:49899] [142656] (1 PDB entry)
  8. 705626Domain d1wsta1: 1wst A:13-415 [121244]
    complexed with plp; mutant

Details for d1wsta1

PDB Entry: 1wst (more details), 1.95 Å

PDB Description: crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
PDB Compounds: (A:) multiple substrate aminotransferase

SCOP Domain Sequences for d1wsta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]}
infdsffsekamlmkasevrellklvetsdvislagglpapetfpvetikkiavevleeh
adkalqygttkgftplrlalarwmekrydipmskveimtvagsqqaldligrvflnpgdp
ivveaptylaaiqafkyydpefisiplddkgmrvdlleekleelrkqgkrvkivytvstf
qnpagvtmsvdrrkkllelaneydflivedgpyselrysgeptppikhfddygrviylgt
fskilapgfrigwvaahphlirkmeiakqsidlctntfgqaiawkyvengyldehipkii
efykprrdamlealeeympegvewtkpeggmfvrvtlpegidtklmmeravakgvayvpg
eaffvhrdkkntmrlnftyvpeetiregvrrlaetikeemkrv

SCOP Domain Coordinates for d1wsta1:

Click to download the PDB-style file with coordinates for d1wsta1.
(The format of our PDB-style files is described here.)

Timeline for d1wsta1: