SCOPe 2.08: Domain d1wssl1: 1wss L:49-86

Lineage for d1wssl1 (1wss L:49-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1wssl1: 1wss L:49-86 [121239]
   Other proteins in same PDB: d1wssh_, d1wssl3, d1wsst1, d1wsst2
   automated match to d1danl1
   complexed with 3cb, bgc, ca, fuc

Details for d1wssl1

PDB Entry: 1wss, 2.6 Å

PDB Description: human factor viia-tissue factor in complex with peptide-mimetic inhibitor that has two charged groups in p2 and p4

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wssl1:

Sequence; same for both SEQRES and ATOM records:

>d1wssl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d1wssl1:

• d1wssl1 first appeared in SCOP 1.73
  
• d1wssl1 appears in SCOPe 2.07