![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein RNase H (RNase HI) [53100] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [53101] (33 PDB entries) Uniprot P0A7Y4 |
![]() | Domain d1wsgd_: 1wsg D: [121237] automated match to d1wsic_ complexed with mn; mutant |
PDB Entry: 1wsg (more details), 2.2 Å
SCOPe Domain Sequences for d1wsgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsgd_ c.55.3.1 (D:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew vkghaghpenercnelaraaamnptledtgyqvev
Timeline for d1wsgd_: