SCOPe 2.08: Domain d1wsgc_: 1wsg C:

Lineage for d1wsgc_ (1wsg C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein RNase H (RNase HI) [53100] (4 species)

7. Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
   Uniprot P0A7Y4

8. Domain d1wsgc_: 1wsg C: [121236]
   automated match to d1wsic_
   complexed with mn; mutant

Details for d1wsgc_

PDB Entry: 1wsg, 2.2 Å

PDB Description: co-crystal structure of e.coli rnase hi active site mutant (e48a/d134n*) with mn2+

PDB Compounds: (C:) ribonuclease hi

SCOPe Domain Sequences for d1wsgc_:

Sequence, based on SEQRES records:

>d1wsgc_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercnelaraaamnptledtgyqvev

Sequence, based on observed residues (ATOM records):

>d1wsgc_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailrektfsagytrttnnrmalmaaivalealkehce
vilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewvkgh
aghpenercnelaraaamnptledtgyqvev

Timeline for d1wsgc_:

• d1wsgc_ first appeared in SCOP 1.73, called d1wsgc1
  
• d1wsgc_ appears in SCOPe 2.07