Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
Protein RNase H (RNase HI) [53100] (3 species) |
Species Escherichia coli [TaxId:562] [53101] (30 PDB entries) |
Domain d1wsga1: 1wsg A:1-155 [121234] complexed with mn; mutant |
PDB Entry: 1wsg (more details), 2.2 Å
SCOP Domain Sequences for d1wsga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsga1 c.55.3.1 (A:1-155) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew vkghaghpenercnelaraaamnptledtgyqvev
Timeline for d1wsga1: