![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
![]() | Protein RNase H (RNase HI) [53100] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [53101] (30 PDB entries) |
![]() | Domain d1wsfa1: 1wsf A:1-155 [121230] complexed with mn; mutant |
PDB Entry: 1wsf (more details), 2.3 Å
SCOP Domain Sequences for d1wsfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wsfa1 c.55.3.1 (A:1-155) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew vkghaghpenercaelaraaamnptledtgyqvev
Timeline for d1wsfa1: