Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein RNase H (RNase HI) [53100] (4 species) |
Species Escherichia coli [TaxId:562] [53101] (33 PDB entries) Uniprot P0A7Y4 |
Domain d1wseb_: 1wse B: [121229] automated match to d1wshb_ complexed with mn; mutant |
PDB Entry: 1wse (more details), 2.3 Å
SCOPe Domain Sequences for d1wseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wseb_ c.55.3.1 (B:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew vkghaghpenercdelaraaamnptledtgyqvev
Timeline for d1wseb_: