SCOP 1.75: Domain d1wseb1: 1wse B:1-155

Lineage for d1wseb1 (1wse B:1-155)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)
   Uniprot P0A7Y4

8. Domain d1wseb1: 1wse B:1-155 [121229]
   automatically matched to 1WSE A:1-155
   complexed with mn; mutant

Details for d1wseb1

PDB Entry: 1wse, 2.3 Å

PDB Description: co-crystal structure of e.coli rnase hi active site mutant (e48a*) with mn2+

PDB Compounds: (B:) ribonuclease hi

SCOP Domain Sequences for d1wseb1:

Sequence; same for both SEQRES and ATOM records:

>d1wseb1 c.55.3.1 (B:1-155) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1wseb1:

• d1wseb1 first appeared in SCOP 1.73
  
• d1wseb1 is called d1wseb_ in SCOPe 2.01
  
• d1wseb1 appears in the current release, SCOPe 2.08, called d1wseb_