Lineage for d1wsca1 (1wsc A:3-227)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010585Fold d.309: AMMECR1-like [143446] (1 superfamily)
    duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand
  4. 3010586Superfamily d.309.1: AMMECR1-like [143447] (1 family) (S)
    automatically mapped to Pfam PF01871
  5. 3010587Family d.309.1.1: AMMECR1-like [143448] (4 proteins)
    Pfam PF01871
  6. 3010594Protein Hypothetical protein ST0229 [143453] (1 species)
  7. 3010595Species Sulfolobus tokodaii [TaxId:111955] [143454] (1 PDB entry)
    Uniprot Q976G0 3-227
  8. 3010596Domain d1wsca1: 1wsc A:3-227 [121227]
    Other proteins in same PDB: d1wscb_

Details for d1wsca1

PDB Entry: 1wsc (more details), 2.45 Å

PDB Description: Crystal structure of ST0229, function unknown protein from Sulfolobus tokodaii
PDB Compounds: (A:) Hypothetical protein ST0229

SCOPe Domain Sequences for d1wsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsca1 d.309.1.1 (A:3-227) Hypothetical protein ST0229 {Sulfolobus tokodaii [TaxId: 111955]}
qeqlvavnelnenlgkvlikiardsianklgilkinledylsslndpilnkkglafvtle
tyygnstslrgcigyveavaplkeivskaaiaaafsdprfpplskgefdniiievtvltk
pqeidvenrwelpkkikvgedgliveygilysglllpqvpmeycwdeetflaetcikagl
epdcwlnnkvkikkfqgiifreekpksekiliikpsevkckkeei

SCOPe Domain Coordinates for d1wsca1:

Click to download the PDB-style file with coordinates for d1wsca1.
(The format of our PDB-style files is described here.)

Timeline for d1wsca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wscb_