Lineage for d1ws9a2 (1ws9 A:2-234)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742756Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 742757Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 742758Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 742765Protein Acyl-CoA dehydrogenase [144024] (1 species)
  7. 742766Species Thermus thermophilus [TaxId:274] [144025] (3 PDB entries)
  8. 742773Domain d1ws9a2: 1ws9 A:2-234 [121224]
    Other proteins in same PDB: d1ws9a1, d1ws9b1

Details for d1ws9a2

PDB Entry: 1ws9 (more details), 2.3 Å

PDB Description: Crystal structure of project ID TT0172 from Thermus thermophilus HB8
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOP Domain Sequences for d1ws9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws9a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay
ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea
lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe
rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallger

SCOP Domain Coordinates for d1ws9a2:

Click to download the PDB-style file with coordinates for d1ws9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ws9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ws9a1