SCOPe 2.01: Domain d1ws6a1: 1ws6 A:15-185

Lineage for d1ws6a1 (1ws6 A:15-185)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.46: YhhF-like [142611] (6 proteins)
   Pfam PF03602

6. Protein Methyltransferase TTHA0928 [142614] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142615] (1 PDB entry)
   Uniprot Q5SJT0 15-185

8. Domain d1ws6a1: 1ws6 A:15-185 [121222]

Details for d1ws6a1

PDB Entry: 1ws6, 2.5 Å

PDB Description: The Structure of Thermus thermphillus HB8 hypothetical protein TTHA0928

PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d1ws6a1:

Sequence; same for both SEQRES and ATOM records:

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}
vvrilggkargvalkvpasarpspvrlrkalfdylrlryprrgrfldpfagsgavgleaa
segweavlvekdpeavrllkenvrrtglgarvvalpvevflpeakaqgerftvafmappy
amdlaalfgellasglveagglyvlqhpkdlylplgerrvygenaltlvev

Timeline for d1ws6a1:

• d1ws6a1 first appeared in SCOP 1.73
  
• d1ws6a1 appears in SCOP 1.75
  
• d1ws6a1 appears in SCOPe 2.02
  
• d1ws6a1 appears in the current release, SCOPe 2.08