Lineage for d1ws6a1 (1ws6 A:15-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894111Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2894120Protein Methyltransferase TTHA0928 [142614] (1 species)
  7. 2894121Species Thermus thermophilus [TaxId:274] [142615] (1 PDB entry)
    Uniprot Q5SJT0 15-185
  8. 2894122Domain d1ws6a1: 1ws6 A:15-185 [121222]

Details for d1ws6a1

PDB Entry: 1ws6 (more details), 2.5 Å

PDB Description: The Structure of Thermus thermphillus HB8 hypothetical protein TTHA0928
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d1ws6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}
vvrilggkargvalkvpasarpspvrlrkalfdylrlryprrgrfldpfagsgavgleaa
segweavlvekdpeavrllkenvrrtglgarvvalpvevflpeakaqgerftvafmappy
amdlaalfgellasglveagglyvlqhpkdlylplgerrvygenaltlvev

SCOPe Domain Coordinates for d1ws6a1:

Click to download the PDB-style file with coordinates for d1ws6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ws6a1: