Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
Protein Urate oxidase (uricase) [55634] (3 species) duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16 |
Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries) |
Domain d1ws2c2: 1ws2 C:137-299 [121211] automated match to d1r56c2 complexed with urn |
PDB Entry: 1ws2 (more details), 2.7 Å
SCOPe Domain Sequences for d1ws2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ws2c2 d.96.1.4 (C:137-299) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]} gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh yfeidlswhkglqntgknaevfapqsdpnglikctvgrsslks
Timeline for d1ws2c2: