SCOPe 2.07: Domain d1wrqb_: 1wrq B:

Lineage for d1wrqb_ (1wrq B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)
   automatically mapped to Pfam PF09021

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein automated matches [190104] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)

8. Domain d1wrqb_: 1wrq B: [121203]
   automated match to d1veab_
   protein/RNA complex; complexed with his, mg

Details for d1wrqb_

PDB Entry: 1wrq, 2.2 Å

PDB Description: crystal structure of hutp-antitermination complex

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wrqb_:

Sequence, based on SEQRES records:

>d1wrqb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Sequence, based on observed residues (ATOM records):

>d1wrqb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

Timeline for d1wrqb_:

• d1wrqb_ first appeared in SCOP 1.73, called d1wrqb1
  
• d1wrqb_ appears in SCOPe 2.06
  
• d1wrqb_ appears in the current release, SCOPe 2.08