Lineage for d1wrqb_ (1wrq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009431Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 3009432Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 3009433Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 3009468Protein automated matches [190104] (2 species)
    not a true protein
  7. 3009469Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)
  8. 3009478Domain d1wrqb_: 1wrq B: [121203]
    automated match to d1veab_
    protein/RNA complex; complexed with his, mg

Details for d1wrqb_

PDB Entry: 1wrq (more details), 2.2 Å

PDB Description: crystal structure of hutp-antitermination complex
PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wrqb_:

Sequence, based on SEQRES records: (download)

>d1wrqb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Sequence, based on observed residues (ATOM records): (download)

>d1wrqb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d1wrqb_:

Click to download the PDB-style file with coordinates for d1wrqb_.
(The format of our PDB-style files is described here.)

Timeline for d1wrqb_: