![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
![]() | Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) ![]() automatically mapped to Pfam PF09021 |
![]() | Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins) |
![]() | Protein automated matches [190104] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries) |
![]() | Domain d1wroc_: 1wro C: [121201] automated match to d1veab_ complexed with ba, his |
PDB Entry: 1wro (more details), 2.35 Å
SCOPe Domain Sequences for d1wroc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wroc_ d.275.1.1 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi avslygtigapikglehetfgvginhi
Timeline for d1wroc_: