Lineage for d1wrob_ (1wro B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009431Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 3009432Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 3009433Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 3009468Protein automated matches [190104] (2 species)
    not a true protein
  7. 3009469Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)
  8. 3009480Domain d1wrob_: 1wro B: [121200]
    automated match to d1veab_
    complexed with ba, his

Details for d1wrob_

PDB Entry: 1wro (more details), 2.35 Å

PDB Description: metal ion dependency of the antiterminator protein, hutp, for binding to the terminator region of hut mrna- a structural basis
PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wrob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrob_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d1wrob_:

Click to download the PDB-style file with coordinates for d1wrob_.
(The format of our PDB-style files is described here.)

Timeline for d1wrob_: