![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
![]() | Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) ![]() |
![]() | Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein) |
![]() | Protein Hut operon positive regulatory protein HutP [111066] (1 species) an RNA-binding antitermination protein |
![]() | Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries) Uniprot P10943 |
![]() | Domain d1wrna1: 1wrn A:5-148 [121196] automatically matched to d1veab_ complexed with his, mn, peg; mutant |
PDB Entry: 1wrn (more details), 2.3 Å
SCOP Domain Sequences for d1wrna1:
Sequence, based on SEQRES records: (download)
>d1wrna1 d.275.1.1 (A:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]} kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs lygtigapikglehetfgvginhi
>d1wrna1 d.275.1.1 (A:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]} kerrigrlsvllllneaestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl ygtigapikglehetfgvginhi
Timeline for d1wrna1: