Lineage for d1wrfa_ (1wrf A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770637Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 1770644Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 1770645Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
    Uniprot Q00855 18-146
  8. 1770652Domain d1wrfa_: 1wrf A: [121195]
    automated match to d2f08a_

Details for d1wrfa_

PDB Entry: 1wrf (more details)

PDB Description: refined solution structure of der f 2, the major mite allergen from dermatophagoides farinae
PDB Compounds: (A:) Mite group 2 allergen Der f 2

SCOPe Domain Sequences for d1wrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrfa_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOPe Domain Coordinates for d1wrfa_:

Click to download the PDB-style file with coordinates for d1wrfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wrfa_: