SCOPe 2.07: Domain d1wrab_: 1wra B:

Lineage for d1wrab_ (1wra B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.8: Pce catalytic domain-like [143921] (1 protein)
   part of Pfam PF00753

6. Protein Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain [143922] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143923] (2 PDB entries)
   Uniprot Q8DQ62 26-334! Uniprot Q8DQ62 30-334

8. Domain d1wrab_: 1wra B: [121191]
   automated match to d1wraa1
   complexed with ca, fe, mpd, pc

Details for d1wrab_

PDB Entry: 1wra, 2 Å

PDB Description: Crystal Structure of Phosphorylcholine Esterase Domain of the Virulence Factor Choline Binding Protein E from Streptococcus Pneumoniae

PDB Compounds: (B:) Teichoic acid phosphorylcholine esterase/choline binding protein E (cbpE)

SCOPe Domain Sequences for d1wrab_:

Sequence; same for both SEQRES and ATOM records:

>d1wrab_ d.157.1.8 (B:) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
essgnkihfinvqeggsdaiilesnghfamvdtgedydfpdgsdsrypwregietsykhv
ltdrvfrrlkelsvqkldfilvththsdhignvdellstypvdrvylkkysdsritnser
lwdnlygydkvlqtatetgvsviqnitqgdahfqfgdmdiqlynyenetdssgelkkiwd
dnsnslisvvkvngkkiylggdldnvhgaedkygpligkvdlmkfnhhhdtnksntkdfi
knlspslivqtsdslpwkngvdseyvnwlkergierinaaskdydatvfdirkdgfvnis
tsykpips

Timeline for d1wrab_:

• d1wrab_ first appeared in SCOP 1.73, called d1wrab1
  
• d1wrab_ appears in SCOPe 2.06
  
• d1wrab_ appears in the current release, SCOPe 2.08