Lineage for d1wrab1 (1wra B:30-334)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736760Family d.157.1.8: Pce catalytic domain-like [143921] (1 protein)
    part of Pfam PF00753
  6. 736761Protein Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain [143922] (1 species)
  7. 736762Species Streptococcus pneumoniae [TaxId:1313] [143923] (2 PDB entries)
  8. 736765Domain d1wrab1: 1wra B:30-334 [121191]
    automatically matched to 1WRA A:30-334
    complexed with ca, fe, mpd, pc

Details for d1wrab1

PDB Entry: 1wra (more details), 2 Å

PDB Description: Crystal Structure of Phosphorylcholine Esterase Domain of the Virulence Factor Choline Binding Protein E from Streptococcus Pneumoniae
PDB Compounds: (B:) Teichoic acid phosphorylcholine esterase/choline binding protein E (cbpE)

SCOP Domain Sequences for d1wrab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrab1 d.157.1.8 (B:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
gnkihfinvqeggsdaiilesnghfamvdtgedydfpdgsdsrypwregietsykhvltd
rvfrrlkelsvqkldfilvththsdhignvdellstypvdrvylkkysdsritnserlwd
nlygydkvlqtatetgvsviqnitqgdahfqfgdmdiqlynyenetdssgelkkiwddns
nslisvvkvngkkiylggdldnvhgaedkygpligkvdlmkfnhhhdtnksntkdfiknl
spslivqtsdslpwkngvdseyvnwlkergierinaaskdydatvfdirkdgfvnistsy
kpips

SCOP Domain Coordinates for d1wrab1:

Click to download the PDB-style file with coordinates for d1wrab1.
(The format of our PDB-style files is described here.)

Timeline for d1wrab1: