SCOP 1.73: Domain d1wrab1: 1wra B:30-334

Lineage for d1wrab1 (1wra B:30-334)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.8: Pce catalytic domain-like [143921] (1 protein)
   part of Pfam PF00753

6. Protein Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain [143922] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143923] (2 PDB entries)

8. Domain d1wrab1: 1wra B:30-334 [121191]
   automatically matched to 1WRA A:30-334
   complexed with ca, fe, mpd, pc

Details for d1wrab1

PDB Entry: 1wra, 2 Å

PDB Description: Crystal Structure of Phosphorylcholine Esterase Domain of the Virulence Factor Choline Binding Protein E from Streptococcus Pneumoniae

PDB Compounds: (B:) Teichoic acid phosphorylcholine esterase/choline binding protein E (cbpE)

SCOP Domain Sequences for d1wrab1:

Sequence; same for both SEQRES and ATOM records:

>d1wrab1 d.157.1.8 (B:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
gnkihfinvqeggsdaiilesnghfamvdtgedydfpdgsdsrypwregietsykhvltd
rvfrrlkelsvqkldfilvththsdhignvdellstypvdrvylkkysdsritnserlwd
nlygydkvlqtatetgvsviqnitqgdahfqfgdmdiqlynyenetdssgelkkiwddns
nslisvvkvngkkiylggdldnvhgaedkygpligkvdlmkfnhhhdtnksntkdfiknl
spslivqtsdslpwkngvdseyvnwlkergierinaaskdydatvfdirkdgfvnistsy
kpips

Timeline for d1wrab1:

• d1wrab1 is new in SCOP 1.73
  
• d1wrab1 appears in SCOP 1.75
  
• d1wrab1 appears in the current release, SCOPe 2.08, called d1wrab_