Lineage for d1wrab_ (1wra B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997169Family d.157.1.8: Pce catalytic domain-like [143921] (1 protein)
    part of Pfam PF00753
  6. 2997170Protein Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain [143922] (1 species)
  7. 2997171Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143923] (2 PDB entries)
    Uniprot Q8DQ62 26-334! Uniprot Q8DQ62 30-334
  8. 2997173Domain d1wrab_: 1wra B: [121191]
    automated match to d1wraa1
    complexed with ca, fe, mpd, pc

Details for d1wrab_

PDB Entry: 1wra (more details), 2 Å

PDB Description: Crystal Structure of Phosphorylcholine Esterase Domain of the Virulence Factor Choline Binding Protein E from Streptococcus Pneumoniae
PDB Compounds: (B:) Teichoic acid phosphorylcholine esterase/choline binding protein E (cbpE)

SCOPe Domain Sequences for d1wrab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrab_ d.157.1.8 (B:) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
essgnkihfinvqeggsdaiilesnghfamvdtgedydfpdgsdsrypwregietsykhv
ltdrvfrrlkelsvqkldfilvththsdhignvdellstypvdrvylkkysdsritnser
lwdnlygydkvlqtatetgvsviqnitqgdahfqfgdmdiqlynyenetdssgelkkiwd
dnsnslisvvkvngkkiylggdldnvhgaedkygpligkvdlmkfnhhhdtnksntkdfi
knlspslivqtsdslpwkngvdseyvnwlkergierinaaskdydatvfdirkdgfvnis
tsykpips

SCOPe Domain Coordinates for d1wrab_:

Click to download the PDB-style file with coordinates for d1wrab_.
(The format of our PDB-style files is described here.)

Timeline for d1wrab_: