![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (63 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d1wr6f1: 1wr6 F:1-73 [121187] Other proteins in same PDB: d1wr6a1, d1wr6b1, d1wr6c1, d1wr6d1 automatically matched to d1aara_ |
PDB Entry: 1wr6 (more details), 2.6 Å
SCOP Domain Sequences for d1wr6f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wr6f1 d.15.1.1 (F:1-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrl
Timeline for d1wr6f1: