Lineage for d1wr1b1 (1wr1 B:328-373)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309397Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2309421Protein DSK2 [140323] (1 species)
  7. 2309422Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (2 PDB entries)
    Uniprot P48510 328-371! Uniprot P48510 328-373
  8. 2309424Domain d1wr1b1: 1wr1 B:328-373 [121185]
    Other proteins in same PDB: d1wr1a_, d1wr1b2

Details for d1wr1b1

PDB Entry: 1wr1 (more details)

PDB Description: the complex structure of dsk2p uba with ubiquitin
PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d1wr1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr1b1 a.5.2.1 (B:328-373) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv

SCOPe Domain Coordinates for d1wr1b1:

Click to download the PDB-style file with coordinates for d1wr1b1.
(The format of our PDB-style files is described here.)

Timeline for d1wr1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wr1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1wr1a_