Lineage for d1wr1b1 (1wr1 B:328-373)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636379Protein DSK2 [140323] (1 species)
  7. 636380Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (3 PDB entries)
  8. 636408Domain d1wr1b1: 1wr1 B:328-373 [121185]
    Other proteins in same PDB: d1wr1a1

Details for d1wr1b1

PDB Entry: 1wr1 (more details)

PDB Description: the complex structure of dsk2p uba with ubiquitin
PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOP Domain Sequences for d1wr1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr1b1 a.5.2.1 (B:328-373) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv

SCOP Domain Coordinates for d1wr1b1:

Click to download the PDB-style file with coordinates for d1wr1b1.
(The format of our PDB-style files is described here.)

Timeline for d1wr1b1: