Lineage for d1wr1a1 (1wr1 A:1-76)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402319Protein Ubiquitin [54238] (7 species)
  7. 1402322Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (7 PDB entries)
  8. 1402328Domain d1wr1a1: 1wr1 A:1-76 [121184]
    Other proteins in same PDB: d1wr1b1
    automatically matched to d1otrb_

Details for d1wr1a1

PDB Entry: 1wr1 (more details)

PDB Description: The complex sturcture of Dsk2p UBA with ubiquitin
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d1wr1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr1a1 d.15.1.1 (A:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d1wr1a1:

Click to download the PDB-style file with coordinates for d1wr1a1.
(The format of our PDB-style files is described here.)

Timeline for d1wr1a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wr1b1