Lineage for d1wr0a1 (1wr0 A:5-81)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481714Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 1481715Family a.7.14.1: MIT domain [116847] (3 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 1481722Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species)
  7. 1481723Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries)
    Uniprot O75351 1-104! Uniprot O75351 1-77
  8. 1481725Domain d1wr0a1: 1wr0 A:5-81 [121183]

Details for d1wr0a1

PDB Entry: 1wr0 (more details)

PDB Description: structural characterization of the mit domain from human vps4b
PDB Compounds: (A:) SKD1 protein

SCOPe Domain Sequences for d1wr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylk

SCOPe Domain Coordinates for d1wr0a1:

Click to download the PDB-style file with coordinates for d1wr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1wr0a1: