SCOPe 2.08: Domain d1wr0a1: 1wr0 A:5-81

Lineage for d1wr0a1 (1wr0 A:5-81)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.1: MIT domain [116847] (4 proteins)
   Pfam PF04212
   this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain

6. Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries)
   Uniprot O75351 1-104! Uniprot O75351 1-77

8. Domain d1wr0a1: 1wr0 A:5-81 [121183]
   Other proteins in same PDB: d1wr0a2

Details for d1wr0a1

PDB Entry: 1wr0

PDB Description: structural characterization of the mit domain from human vps4b

PDB Compounds: (A:) SKD1 protein

SCOPe Domain Sequences for d1wr0a1:

Sequence; same for both SEQRES and ATOM records:

>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylk

Timeline for d1wr0a1:

• d1wr0a1 first appeared in SCOP 1.73
  
• d1wr0a1 appears in SCOPe 2.07