SCOPe 2.08: Domain d1wqwb2: 1wqw B:1-188

Lineage for d1wqwb2 (1wqw B:1-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
   Uniprot O57883 1-188

8. Domain d1wqwb2: 1wqw B:1-188 [121182]
   Other proteins in same PDB: d1wqwa1, d1wqwb1
   automated match to d1wnla2
   complexed with bt5

Details for d1wqwb2

PDB Entry: 1wqw, 1.45 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 in complex with Biotinyl-5-AMP

PDB Compounds: (B:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d1wqwb2:

Sequence; same for both SEQRES and ATOM records:

>d1wqwb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d1wqwb2:

• d1wqwb2 first appeared in SCOP 1.73
  
• d1wqwb2 appears in SCOPe 2.07