Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins) |
Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries) Uniprot O57883 1-188 |
Domain d1wqwa2: 1wqw A:1-188 [121180] Other proteins in same PDB: d1wqwa1, d1wqwb1 automatically matched to 1WNL A:1-188 complexed with bt5 |
PDB Entry: 1wqw (more details), 1.45 Å
SCOPe Domain Sequences for d1wqwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d1wqwa2: