Lineage for d1wqvt1 (1wqv T:6-108)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935829Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 935858Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 935879Domain d1wqvt1: 1wqv T:6-108 [121177]
    Other proteins in same PDB: d1wqvh_, d1wqvl1, d1wqvl2, d1wqvl3
    automatically matched to d1a21a1
    complexed with bgc, ca, fuc, psm

Details for d1wqvt1

PDB Entry: 1wqv (more details), 2.5 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with propylsulfonamide-D-Thr-Met-p-aminobenzamidine
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wqvt1:

Sequence, based on SEQRES records: (download)

>d1wqvt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d1wqvt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

SCOPe Domain Coordinates for d1wqvt1:

Click to download the PDB-style file with coordinates for d1wqvt1.
(The format of our PDB-style files is described here.)

Timeline for d1wqvt1: