Lineage for d1wqvl2 (1wqv L:87-142)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961216Protein Coagulation factor VIIa [57201] (1 species)
  7. 1961217Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1961259Domain d1wqvl2: 1wqv L:87-142 [121175]
    Other proteins in same PDB: d1wqvh_, d1wqvl3, d1wqvt1, d1wqvt2
    automated match to d1danl2
    complexed with bgc, ca, fuc, psm

Details for d1wqvl2

PDB Entry: 1wqv (more details), 2.5 Å

PDB Description: human factor viia-tissue factor complexed with propylsulfonamide-d- thr-met-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wqvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqvl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1wqvl2:

Click to download the PDB-style file with coordinates for d1wqvl2.
(The format of our PDB-style files is described here.)

Timeline for d1wqvl2: