Lineage for d1wqvl1 (1wqv L:46-82)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889703Protein Factor IX (IXa) [57198] (2 species)
  7. 889713Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 889728Domain d1wqvl1: 1wqv L:46-82 [121174]
    Other proteins in same PDB: d1wqvh1, d1wqvl3, d1wqvt1, d1wqvt2
    automatically matched to d1pfxl1
    complexed with bgc, ca, fuc, psm

Details for d1wqvl1

PDB Entry: 1wqv (more details), 2.5 Å

PDB Description: human factor viia-tissue factor complexed with propylsulfonamide-d- thr-met-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d1wqvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqvl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOP Domain Coordinates for d1wqvl1:

Click to download the PDB-style file with coordinates for d1wqvl1.
(The format of our PDB-style files is described here.)

Timeline for d1wqvl1: