Lineage for d1wqlb1 (1wql B:5-186)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936661Protein Small subunit of cumene dioxygenase CumA2 [142997] (1 species)
  7. 2936662Species Pseudomonas fluorescens [TaxId:294] [142998] (1 PDB entry)
    Uniprot Q51744 6-186
  8. 2936663Domain d1wqlb1: 1wql B:5-186 [121172]
    Other proteins in same PDB: d1wqla1, d1wqla2
    complexed with fe2, fes, oxy

Details for d1wqlb1

PDB Entry: 1wql (more details), 2.2 Å

PDB Description: Cumene dioxygenase (cumA1A2) from Pseudomonas fluorescens IP01
PDB Compounds: (B:) ethylbenzene dioxygenase small subunit

SCOPe Domain Sequences for d1wqlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]}
dltkpiewpempvslelqnaveqfyyreaqlldyqnyeawlalltqdiqywmpirtthts
rnkameyvppggnahfdetyesmrarirarvsglnwtedppsrsrhivsnvivretesag
tlevssaflcyrnrlermtdiyvgerrdillrvsdglgfkiakrtilldqstitannlsq
ff

SCOPe Domain Coordinates for d1wqlb1:

Click to download the PDB-style file with coordinates for d1wqlb1.
(The format of our PDB-style files is described here.)

Timeline for d1wqlb1: