Lineage for d1wqla2 (1wql A:181-459)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926476Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1926505Protein Large subunit of cumene dioxygenase cumA1 [143825] (1 species)
  7. 1926506Species Pseudomonas fluorescens [TaxId:294] [143826] (1 PDB entry)
    Uniprot Q51743 181-459
  8. 1926507Domain d1wqla2: 1wql A:181-459 [121171]
    Other proteins in same PDB: d1wqla1, d1wqlb1
    complexed with fe2, fes, oxy

Details for d1wqla2

PDB Entry: 1wql (more details), 2.2 Å

PDB Description: Cumene dioxygenase (cumA1A2) from Pseudomonas fluorescens IP01
PDB Compounds: (A:) iron-sulfur protein large subunit of cumene dioxygenase

SCOPe Domain Sequences for d1wqla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqla2 d.129.3.3 (A:181-459) Large subunit of cumene dioxygenase cumA1 {Pseudomonas fluorescens [TaxId: 294]}
apdlktylsdatpymdvmldrteavtqvitgmqktvipcnwkfaaeqfcsdmyhagtmah
lsgvlsslppemdlsqvklpssgnqfrakwgghgtgwfnddfallqaimgpkvvdywtkg
paaerakerlgkvlpadrmvaqhmtifptcsflpgintvrtwhprgpneievwsfivvda
dapedikeeyrrkniftfnqggtyeqddgenwvevqrglrgykarsrplcaqmgagvpnk
nnpefpgktsyvyseeaargfyhhwsrmmsepswdtlks

SCOPe Domain Coordinates for d1wqla2:

Click to download the PDB-style file with coordinates for d1wqla2.
(The format of our PDB-style files is described here.)

Timeline for d1wqla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wqla1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wqlb1