SCOPe 2.08: Domain d1wq2b_: 1wq2 B:

Lineage for d1wq2b_ (1wq2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)
   automatically mapped to Pfam PF08679

6. Protein automated matches [190106] (1 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:881] [186830] (1 PDB entry)

8. Domain d1wq2b_: 1wq2 B: [121162]
   automated match to d1ucrb_
   complexed with dod, so4

Details for d1wq2b_

PDB Entry: 1wq2, 2.4 Å

PDB Description: neutron crystal structure of dissimilatory sulfite reductase d (dsrd)

PDB Compounds: (B:) Protein dsvD

SCOPe Domain Sequences for d1wq2b_:

Sequence, based on SEQRES records:

>d1wq2b_ a.4.5.45 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkga

Sequence, based on observed residues (ATOM records):

>d1wq2b_ a.4.5.45 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnskskskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttm
yglkga

Timeline for d1wq2b_:

• d1wq2b_ first appeared in SCOP 1.73, called d1wq2b1
  
• d1wq2b_ appears in SCOPe 2.07