Lineage for d1wq2a_ (1wq2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307549Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)
    automatically mapped to Pfam PF08679
  6. 2307554Protein automated matches [190106] (1 species)
    not a true protein
  7. 2307555Species Desulfovibrio vulgaris [TaxId:881] [186830] (1 PDB entry)
  8. 2307556Domain d1wq2a_: 1wq2 A: [121161]
    automated match to d1ucrb_
    complexed with dod, so4

Details for d1wq2a_

PDB Entry: 1wq2 (more details), 2.4 Å

PDB Description: neutron crystal structure of dissimilatory sulfite reductase d (dsrd)
PDB Compounds: (A:) Protein dsvD

SCOPe Domain Sequences for d1wq2a_:

Sequence, based on SEQRES records: (download)

>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagk

Sequence, based on observed residues (ATOM records): (download)

>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttmygl
kgagk

SCOPe Domain Coordinates for d1wq2a_:

Click to download the PDB-style file with coordinates for d1wq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wq2a_: