SCOP 1.73: Domain d1wq2a1: 1wq2 A:1-70

Lineage for d1wq2a1 (1wq2 A:1-70)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (1 protein)

6. Protein Dissimilatory sulfite reductase DsvD [101049] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [101050] (2 PDB entries)

8. Domain d1wq2a1: 1wq2 A:1-70 [121161]
   automatically matched to d1ucrb_
   complexed with so4

Details for d1wq2a1

PDB Entry: 1wq2, 2.4 Å

PDB Description: neutron crystal structure of dissimilatory sulfite reductase d (dsrd)

PDB Compounds: (A:) Protein dsvD

SCOP Domain Sequences for d1wq2a1:

Sequence, based on SEQRES records:

>d1wq2a1 a.4.5.45 (A:1-70) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagk

Sequence, based on observed residues (ATOM records):

>d1wq2a1 a.4.5.45 (A:1-70) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttmygl
kgagk

Timeline for d1wq2a1:

• d1wq2a1 is new in SCOP 1.73
  
• d1wq2a1 appears in SCOP 1.75
  
• d1wq2a1 appears in the current release, SCOPe 2.08, called d1wq2a_