Lineage for d1wpyb2 (1wpy B:1-188)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730883Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 730892Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 730893Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (10 PDB entries)
  8. 730901Domain d1wpyb2: 1wpy B:1-188 [121160]
    Other proteins in same PDB: d1wpya1, d1wpyb1
    automatically matched to 1WNL A:1-188
    complexed with btn

Details for d1wpyb2

PDB Entry: 1wpy (more details), 1.6 Å

PDB Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with biotin
PDB Compounds: (B:) biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d1wpyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpyb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOP Domain Coordinates for d1wpyb2:

Click to download the PDB-style file with coordinates for d1wpyb2.
(The format of our PDB-style files is described here.)

Timeline for d1wpyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpyb1