SCOPe 2.08: Domain d1wpvb_: 1wpv B:

Lineage for d1wpvb_ (1wpv B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)
   automatically mapped to Pfam PF09021

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein automated matches [190104] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)

8. Domain d1wpvb_: 1wpv B: [121154]
   automated match to d1veab_
   protein/RNA complex; complexed with his, mg

Details for d1wpvb_

PDB Entry: 1wpv, 1.7 Å

PDB Description: crystal structure of activated binary complex of hutp, an rna binding anti-termination protein

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wpvb_:

Sequence; same for both SEQRES and ATOM records:

>d1wpvb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Timeline for d1wpvb_:

• d1wpvb_ first appeared in SCOP 1.73, called d1wpvb1
  
• d1wpvb_ appears in SCOPe 2.07