Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) |
Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein) |
Protein Hut operon positive regulatory protein HutP [111066] (1 species) an RNA-binding antitermination protein |
Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries) |
Domain d1wpva1: 1wpv A:5-148 [121153] automatically matched to d1veab_ complexed with his, mg; mutant |
PDB Entry: 1wpv (more details), 1.7 Å
SCOP Domain Sequences for d1wpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpva1 d.275.1.1 (A:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]} kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs lygtigapikglehetfgvginhi
Timeline for d1wpva1: