Lineage for d1wpub1 (1wpu B:5-148)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881860Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 881861Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
  5. 881862Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)
  6. 881863Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 881864Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)
    Uniprot P10943
  8. 881866Domain d1wpub1: 1wpu B:5-148 [121152]
    automatically matched to d1veab_
    complexed with his, mg; mutant

Details for d1wpub1

PDB Entry: 1wpu (more details), 1.48 Å

PDB Description: crystal structure of the hutp antitermination complex bound to a single stranded region of hut mrna
PDB Compounds: (B:) Hut operon positive regulatory protein

SCOP Domain Sequences for d1wpub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpub1 d.275.1.1 (B:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

SCOP Domain Coordinates for d1wpub1:

Click to download the PDB-style file with coordinates for d1wpub1.
(The format of our PDB-style files is described here.)

Timeline for d1wpub1: