Lineage for d1wpua_ (1wpu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615267Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 2615268Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 2615269Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 2615303Protein automated matches [190104] (2 species)
    not a true protein
  7. 2615304Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)
  8. 2615305Domain d1wpua_: 1wpu A: [121151]
    automated match to d1veab_
    protein/RNA complex; complexed with his, mg

Details for d1wpua_

PDB Entry: 1wpu (more details), 1.48 Å

PDB Description: crystal structure of the hutp antitermination complex bound to a single stranded region of hut mrna
PDB Compounds: (A:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpua_ d.275.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d1wpua_:

Click to download the PDB-style file with coordinates for d1wpua_.
(The format of our PDB-style files is described here.)

Timeline for d1wpua_: