Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) automatically mapped to Pfam PF09021 |
Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins) |
Protein automated matches [190104] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries) |
Domain d1wpsa_: 1wps A: [121147] automated match to d1veab_ |
PDB Entry: 1wps (more details), 2.8 Å
SCOPe Domain Sequences for d1wpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpsa_ d.275.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl ygtigapikglehetfgvginhi
Timeline for d1wpsa_: