SCOP 1.75: Domain d1wpsa1: 1wps A:6-148

Lineage for d1wpsa1 (1wps A:6-148)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)
   Uniprot P10943

8. Domain d1wpsa1: 1wps A:6-148 [121147]
   automatically matched to d1veab_
   mutant

Details for d1wpsa1

PDB Entry: 1wps, 2.8 Å

PDB Description: crystal structure of hutp, an rna binding anti-termination protein

PDB Compounds: (A:) Hut operon positive regulatory protein

SCOP Domain Sequences for d1wpsa1:

Sequence; same for both SEQRES and ATOM records:

>d1wpsa1 d.275.1.1 (A:6-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

Timeline for d1wpsa1:

• d1wpsa1 first appeared in SCOP 1.73
  
• d1wpsa1 is called d1wpsa_ in SCOPe 2.01
  
• d1wpsa1 appears in the current release, SCOPe 2.08, called d1wpsa_