Lineage for d1wpsa1 (1wps A:6-148)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741266Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 741267Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
  5. 741268Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)
  6. 741269Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 741270Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)
  8. 741291Domain d1wpsa1: 1wps A:6-148 [121147]
    automatically matched to d1veab_
    mutant

Details for d1wpsa1

PDB Entry: 1wps (more details), 2.8 Å

PDB Description: crystal structure of hutp, an rna binding anti-termination protein
PDB Compounds: (A:) Hut operon positive regulatory protein

SCOP Domain Sequences for d1wpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpsa1 d.275.1.1 (A:6-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

SCOP Domain Coordinates for d1wpsa1:

Click to download the PDB-style file with coordinates for d1wpsa1.
(The format of our PDB-style files is described here.)

Timeline for d1wpsa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wpsb1