Lineage for d1wpia1 (1wpi A:1-133)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486794Family c.47.1.18: YKR049C-like [142395] (1 protein)
    Pfam PF07955; DUF1687; contains an all-alpha insert subdomain
  6. 2486795Protein Hypothetical protein YKR049C [142396] (1 species)
  7. 2486796Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142397] (1 PDB entry)
    Uniprot P36141 1-133
  8. 2486797Domain d1wpia1: 1wpi A:1-133 [121146]

Details for d1wpia1

PDB Entry: 1wpi (more details)

PDB Description: solution nmr structure of protein ykr049c from saccharomyces cerevisiae. ontario centre for structural proteomics target yst0250_1_133; northeast structural genomics consortium ytyst250
PDB Compounds: (A:) Hypothetical 15.6 kDa protein in NAP1-TRK2 intergenic region

SCOPe Domain Sequences for d1wpia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpia1 c.47.1.18 (A:1-133) Hypothetical protein YKR049C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msfwktlqrqprtislftndiasniksqkclqllkgdvshrfdveianrfptwdqlqymr
tscpqgpvslqrqipkldsvlkykhtdptfgmdlqkcvqrglwnpkealwvdwenklvgn
epadidkyiiqrk

SCOPe Domain Coordinates for d1wpia1:

Click to download the PDB-style file with coordinates for d1wpia1.
(The format of our PDB-style files is described here.)

Timeline for d1wpia1: