![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.18: YKR049C-like [142395] (1 protein) Pfam PF07955; DUF1687; contains an all-alpha insert subdomain |
![]() | Protein Hypothetical protein YKR049C [142396] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142397] (1 PDB entry) Uniprot P36141 1-133 |
![]() | Domain d1wpia1: 1wpi A:1-133 [121146] |
PDB Entry: 1wpi (more details)
SCOPe Domain Sequences for d1wpia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpia1 c.47.1.18 (A:1-133) Hypothetical protein YKR049C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msfwktlqrqprtislftndiasniksqkclqllkgdvshrfdveianrfptwdqlqymr tscpqgpvslqrqipkldsvlkykhtdptfgmdlqkcvqrglwnpkealwvdwenklvgn epadidkyiiqrk
Timeline for d1wpia1: