Lineage for d1wpaa1 (1wpa A:416-522)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1970480Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 1970611Superfamily h.4.17: occludin/ELL-like [144292] (1 family) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 1970612Family h.4.17.1: Occludin/ELL domain [144293] (1 protein)
    Pfam PF07303
  6. 1970613Protein Occludin [144294] (1 species)
  7. 1970614Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries)
    Uniprot Q16625 416-522
  8. 1970616Domain d1wpaa1: 1wpa A:416-522 [121145]

Details for d1wpaa1

PDB Entry: 1wpa (more details), 1.5 Å

PDB Description: 1.5 Angstrom crystal structure of human occludin fragment 413-522
PDB Compounds: (A:) Occludin

SCOPe Domain Sequences for d1wpaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpaa1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]}
wireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreeseeym
aaadeynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt

SCOPe Domain Coordinates for d1wpaa1:

Click to download the PDB-style file with coordinates for d1wpaa1.
(The format of our PDB-style files is described here.)

Timeline for d1wpaa1: