Lineage for d1wp9a1 (1wp9 A:1-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870833Protein putative ATP-dependent RNA helicase PF2015, N-terminal domain [419076] (1 species)
    separate structures of other domains are known: the middle nuclease domain (89718) and the C-terminal RuvA-like HhH domain (PDB 1x2i)
  7. 2870834Species Pyrococcus furiosus [TaxId:2261] [419576] (1 PDB entry)
  8. 2870835Domain d1wp9a1: 1wp9 A:1-200 [121143]
    Other proteins in same PDB: d1wp9a2, d1wp9b2, d1wp9c2, d1wp9d2, d1wp9e2, d1wp9f2
    complexed with po4

Details for d1wp9a1

PDB Entry: 1wp9 (more details), 2.9 Å

PDB Description: crystal structure of pyrococcus furiosus hef helicase domain
PDB Compounds: (A:) ATP-dependent RNA helicase, putative

SCOPe Domain Sequences for d1wp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
mvlrrdliqpriyqeviyakcketnclivlptglgktliammiaeyrltkyggkvlmlap
tkplvlqhaesfrrlfnlppekivaltgekspeerskawarakvivatpqtiendllagr
isledvslivfdeahravgnyayvfiareykrqaknplvigltaspgstpekimevinnl
giehieyrsenspdvrpyvk

SCOPe Domain Coordinates for d1wp9a1:

Click to download the PDB-style file with coordinates for d1wp9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wp9a1: